- Related Category:
- Agriculture(82)
- Apparel & Clothing(11)
- Automobiles & Motorcycles(3)
- Beauty & Personal Care(7)
- Business Services(10)
- Chemicals, Plastics, and Raw Materials(9)
- Construction & Real Estate(1)
- Electrical Equipment & Supplies(1)
- Energy Products(5)
- Environment(3)
- Excess Inventory(1)
- Fashion Accessories(3)
- Food & Beverage(4)
- Furniture & Furnishings(4)
- Gifts & Crafts(3)
- Health & Medicines(12)
- Home & Garden(14)
- Jewelry & Watches(6)
- Lights & Lighting(2)
- Luggage, Bags & Cases(2)
- Manufacturing & Processing Machinery(1)
- Measurement & Analysis Instruments(1)
- Minerals & Metallurgy(4)
- Office & School Supplies(2)
- Sports & Entertainment(3)
- Textiles & Leather Products(16)
- Tools(2)
- Toys & Hobbies(14)
-
Mesa Verde Trading Co. Inc
Feed and grain trading enterprise. All livestock species. Pet food ingredients. Example Almond Hulls Almond Shell Bakery by product
Telephone:559 - 625 - 3055Address:4545 N West Ave # 119A Fresno CA 93705 United States
-
Black Horse Trading Company
Company opening for business March 2012. Will be selling feed, farm supplies, garden supplies and tools, animal health and footwear
Telephone:1-404-3247916Address:21 Fields Road, Kingston, GA, USA
-
Higher Ground Energy Solutions, Inc
wddkhfeikncwoihiwhiinifknidsancidnirenkvniriwidekfmfnfjfjfjfjfkdddmdmjejejenemelldkfjffnremememjfjfjfjmnfnrerjekjkfkfmrfnrenrejf
Telephone:1-256-7568876Address:602 sweetwater ave, florence, alabama, USA
-
ACS TRADING CORPORATION
Trading and manufacturing company established in 1977. Suppliers of agricultural commodities such as soybeans, soy bean meal, yucca schidigera, fishmeal, fish oil& other animal feeds additives. For complete details specifications please visit us. ...
Telephone:1-530-672-6565Address:P. O. Box 4679
-
Global Wholesale Experts Inc
Our company has been in existence for the past year serving clients US and Caribbean. As a distrabution/wholesale we have an extensive product listing. are not limited to what\'s seen on our main page. Feel free inquire other products listed. We pride ourselves competitive pricing timely most ...
Telephone:1-8882809210Address:4521 PGA BLVD, Palm Beach Gardens, Florida, USA
-
Simpsson Feed Mills and Food Limited
We SIMPSSON FEED MILLS & FOODS LIMITED is company based in the United States and we have been operating for more than 10 years now,and one of largest manufacturer here States.We also exporting to various countries world like;Asia,Europe,Americas,Africa rest just name a few. We ...
Telephone:1 - 262 - 6437773Address:5 Applegate Ct Madison, WI 53713 Madison Wisconsin 53713 United States
-
Emily's Violin Company
Welcome to emily's violin co. We are in business serve our community with unique and unusual instruments, accessories supplies. experts bows bow hair. For over 16 years, we have been importing trading the highest quality double-drawn horse tail hair industry. sell top music shops North ...
Telephone:1-413-2654129Address:151 Russell St
-
Telesis Animal Health, INC.
We specialize in horse and animal care products. Ten years as president of non-profit rescue specializing abuse, neglect, medical cases. Herbal chemical background enabled me to discover what works, holes could be better filled the industry, by formulating Currently are selling four major ...
Telephone:001-850-9482800Address:421 N. W. Bailey Grade Road
-
Western Milling,LLC
We are offering prepared animal feeds for many species. Horse, Cattle, Chicken, Pig, Dog, Cat, etc. Bagged and ready to feed.
Telephone:001-559-3021000Address:31120 west st, goshen, ca, USA
-
Agri-Management, Inc.
We are a commercial farm, with appropriate equipment and practices. Â We grow animal forage including Timothy hay, alfalfa corn as either sileage or grain. asparagus for human consumption, various cereal grains consumption. ...
Telephone:1-5098404004Address:Mattawa, Washington, USA
-
Sigma Global Marketing, Ltd.
Sigma works as a sells and purchasing agent for several firms in Canada, Japan, Taiwan, peru USA. We put handle from container load shipments to large volume contract business. Our main products are feed fish farms, pet foods frozen products. ...
Telephone:1-360-297-5828Address:P. O. Box 1057
-
Westchester Raccoon Removal
We have been trapping, removing and humanely controlling the raccoon population for the last 26 years. We remove raccoons from New York, New Jersey and Connecticut.
Telephone:1-914-8163008Address:333 Mamaroneck Ave #220, White Plains, New York, USA
-
www.chestainc.com
Chesta Inc, working as a manufacturer representative from last 9 years. we are supplying goods to US retail Chain stores. We also chemicals, pharma raw materials, essential oils, dyes, & pigments direct manufacturer., If anyone looking good reliable source please contact ...
Telephone:1-267-2939551Address:2900 Knights rd Suit C21
-
Nusantara Capital LLC
Nusantara Capital LLC is a globally reaching firm focused on the facilitation of international trade transactions. We concentrate our efforts in sourcing and procurement large volumes base metal resources (such as lead, zinc, copper, manganese) commodity related products cement, ...
Telephone:1-4084570790Address:USA
-
John's Salt Service Inc.
Johns Salt Service Inc. is proud to be among the chosen few represent Morton as a Certified Distributor. Our woman owned, small business has represented for over 30 years. We have national reputation quality, dependability and expertise any of your salt requirements. With our variety screening ...
Telephone:011-510-7709777Address:38507 Cherry Street Unit G
-
GreenSun Products, LLC
GreenSun Products, LLC offers sustainably grown, dried and pelleted duckweed meal for herbal medicines, as well as high protein animal feed supplements. All duckweed is indirect light solar dried to retain beta carotenes.Â
Telephone:1-2703560208Address:Mayfield, Kentucky, USA
-
Global Trade Company Ltd
GLOBAL TRADE COMPANY LTD located in Woluwelaan, 201 Machelen, B-1830, Belgium with branch office Greece and Thailand was established 1995 by ABDUL MUHAYMIN Chairman, who has been managing business for over 15 years. The activity of the firm is focused on manufacturing, potting distribution ...
Telephone:1-8507781861Address:ewusie, Chicago, Illinois, USA
-
Stuffable Buddies
Independent Representative of CJ Critter Club along with many other products including but not limited to DVDs, CDs, Software and books. Established in 2006 added as a product line 2007. We also sell on the online auction venues Ebay Yahoo. ...
Telephone:1-816-4784970Address:16419 E Cogan Rd, Independence, MO, USA
-
Barsch Animal Clinic
Specializing in veterinary medicine and surgical services. Practicing a total health concept to support health and longevity.
Telephone:1 - 962 - 7117Address:9999 Plantation Blvd Tampa Fl 33624 United States
-
Oxford Feed & Lumber
Oxford Feed and Lumber is a retail seller of animal and pet feeds and supplies, along with lumber and building materials. Three locations is Pa.
Telephone:001-610-9328521Address:railroad ave., oxford, pa, USA
Refine by Country
- Australia
- Bangladesh
- Brazil
- Cameroon
- Canada
- China
- Egypt
- Germany
- Hong Kong
- India
- Indonesia
- Iran
- Italy
- Japan
- Malaysia
- Mexico
- Netherlands
- Nigeria
- Pakistan
- Philippines
- Poland
- Russian Federation
- Singapore
- South Africa
- South Korea
- Spain
- Sri Lanka
- Taiwan
- Thailand
- Turkey
- Ukraine
- United Arab Emirates
- United Kingdom
- United States
- Vietnam