- Related Regions:
- Australia(116)
- Bangladesh(18)
- Brazil(27)
- Cameroon(9)
- Canada(105)
- China(8911)
- Egypt(35)
- France(25)
- Germany(55)
- Hong Kong(614)
- India(385)
- Indonesia(217)
- Iran(10)
- Italy(53)
- Japan(53)
- Malaysia(137)
- Mexico(32)
- Netherlands(43)
- Nigeria(11)
- Pakistan(52)
- Philippines(54)
- Poland(41)
- Russian Federation(34)
- Saudi Arabia(17)
- Singapore(104)
- South Africa(60)
- South Korea(139)
- Spain(37)
- Sri Lanka(41)
- Taiwan(170)
- Thailand(138)
- Turkey(120)
- Ukraine(20)
- United Arab Emirates(48)
- United Kingdom(210)
- United States(881)
- Vietnam(79)
-
Higher Ground Energy Solutions, Inc
wddkhfeikncwoihiwhiinifknidsancidnirenkvniriwidekfmfnfjfjfjfjfkdddmdmjejejenemelldkfjffnremememjfjfjfjmnfnrerjekjkfkfmrfnrenrejf
Telephone:1-256-7568876Address:602 sweetwater ave, florence, alabama, USA
-
Hoking Plastic Factory Ltd
We\'re manufacturer and exporter of plastic toys(solf hard plastic), products for babies, gift items. All our have passed several international certifications, such as EN71, ASTM, RoHS, PAHs REACH etc., with many years\' experiences top-grade workers, always meet customers\' ...
Telephone:86-769-82976471Address:Huangcaolang Industrial, Dalang Town
-
Rhine Toys & Gift LTD
ICTI-certificated factory for your plush toys and baby toys,Designed and produced with our love,Sample delivery in 5days,Monthly Capacity up to 200,000 Pieces
Telephone:86 - 0769 - 38912767Address:Zhongxin Industrial Park,Shipai Town,Dongguan City,China Dongguan Guangdong 523332 China
-
YALLY INDUSTRIAL CO., LIMITED
Our company is specialized in inflatable bouncer,inflatable game,inflatable castle,inflatable obstacle ,inflatable slide,inflatable tent.welcome inquiry us
Telephone:0108-20-3661-0108Address:48TH.WEST GAOQIAO ROAD,LONGGUI,BAIYUN,GUANGZHOU,CHINA
-
Yangjiang Ditiantai Industrial
We are Yangjiang Ditiantai Industrial based in Yangjiang, China. member of TradeKey.com since July, 2012. Our business is related to Hardware & Mechanical Parts industry and we specifically deal scissors,pocket knives,manicure set. Please find our product details below: poultry scissors ...
Telephone:86-662-3661538Address:No.B2-502, Yushuiyazhu, Huanhuzhong Road,Yangjiang,Guangdong,China, Yangjiang, Guangdong, China
-
S & T Hand-made Company
S & T hand-made Company was found in Guangzhou,China.Our main products is all hand-made traditional toys,decorations,wallets and so on.
Telephone:86-02081916765Address:Room 601,No.160,Tiancheng Road,Yuexiu Area, Guangzhou, Guangdong, China
-
HK Ideal Color Printing.,
Guangdong ideal Color Printing Co., Ltd. is a set design, printing and processing in an integrated companies. Specializing the production of high-grade color box, cards, gift boxes, catalogs, publications, trademarks, silk screen, multi-functional office paper all kinds stamping other ...
Telephone:86-75588377519Address:Shenzhen, Guangdong, China
-
AOSHIMA BUNKA KYOZAI CO. LTD.
We, aoshima, are one of the top-ranking manufacturers plastic and diecast toys such as car, airplane, battleship, rc car in Japan, having a business background more than decade. Moreover, we have been cooperating with tamiya some businesses. The high praise accorded to our products both at ...
-
Clegg Exporting Company Limited
our company has successfully developed herself into a toy enterprise. We specialize in producing educational, safe and fun oriented products using non-toxic wooden materials paints. Furthermore, our are designed to offer kids good chances learn colors, distinguish shapes understand ...
Telephone:86 - 10 - 6970012Address:No. 601 Fu Xing Men Nei Street Beijing 100031, China Beijing Beijing 100031 China
-
LangFang YongXin Musical Instruments Co., Ltd
Lang Fang Yong Xin Musical Instruments Co., Ltd is a professional manufacture of percussion with the export by ourselves. The primary focus our product line Tambourine, Maracas , Guiro, Xylophone, Metallophone, Bells more than 4 hundred kins percussion. Our factory locates between Tianjin ...
Telephone:86-316-2820916Address:yuchangfu, Langfang, Hebei, China
-
Guangzhou Hongqiao Plastic Co., Ltd
Guangzhou Hongqiao Plastic Co., Ltd. is a professional company specialized in plastic products, located in Guangzhou City. We have the professional factory. We have 5 years\' experience in the plastic industry. Our company is young and lifeful.
Telephone:86-20-3613-7405Address:room 8801,,146 huijin building, huang bian bei lu,baiyun district
-
Hebei Tieniu Bicycle Industry Co., Ltd
Hebei tieniu bicycle industry co., ltd is specializing in the prodction of children bicycle and bicycle parts, known for the excellent uality and dedicated service.
Telephone:86-0319-13223286329Address:xingtai, Xingtai, Hebei, China
-
Shenzhen Xinhejintai Plastic And Rubber Co., Ltd
Shenzhen Xin He Jin Tai Plastic & Rubber Co., Ltd. is a manufacturer of EVA foam products with good reputation and high quality. Main includes toys, wall decorations, mats, sheets, slippers sandals, hats, etc. Supplying for Disney, WALMART, TARGET Michaels at the present. "Rainbow" ...
Telephone:86-75584873366Address:Shenzhen, Guangdong, China
-
China Linkwin Industrial Co., Ltd
CHINA LINKWIN INDUSTRIAL CO., LTD Was Founded In The Year 2002, Which Integrating Designing, Develops, Production, Research And Marketing .Major RC TOYS, HOBBY, xxxxx Products Comply With International Quality Standards Were Approvaled CE, FCC, ROHS. So Far Have Been Exported products To ...
Telephone:86-754-86391680Address:chaoshan, shantou, GuangDong, China
-
JINDALI TOYS LIMITED
JINDALI can provide includes manufacturing plastic toys, design and sourcing new items, quality inspection etc. We believe our valued experiences in all aspect benefit your organization development enlarge market shares. For more please mail to [email protected] ...
Telephone:86-75489311833Address:Chenghai, shantou, Guangdong, China
-
PHILIS POP HOLDINGS LTD.
OUR COMPANY: PHILIS POP HOLDINGS LTD. is one of the top ranking manufacturers for inflatable products in international market. Inflatable Products are available swimming, skiing and amusement, furniture, gifts or toys, we also produce various plastic nylon such as bags, handbags, backpack, ...
Telephone:86-020-86097917Address:Xinke Industry, Guangzhou, Guangdong, China
-
FUyuan RC Modle Co., Ltd.
Established in 2000, Fuyuan R/C Model Co., Ltd. specializes the development and manufacturing Radio Control (RC) industry for many years. Our head office is located downtown Guangzhou. We have top quality production lines RC products over 30 professional CNC machines at our factory. With ...
Telephone:86-020-87743718Address:Other, China
-
Fortune Long Toy (Shenzhen)Co., LTD
Our company has been founded in the beginning of nineteen ninety .Primarily produce plush toys and sorts ***** meantime, we set up three factorybuildings total area upto 10000 square meter.Also, passed ISO9001 attestation international quality management, have management professional ...
Telephone:86-0755-89627888Address:Zhang Bei Industrial Ailian Village Long Gang Town, Shenzhen, Guangdong, China
-
Xiamen Ying Wan Foodstuff Co., LTD.
We Xiamen Ying Wan Foodstuff specialized in confectionery manufacturing with main line of candy and toys candy, we have almost 1,000 different designs, including jelly bean pressed soft hard also lollipop mint are our series. What\\\'s more, do customizing for clients. More than 17 years? ...
Telephone:86 - 592 - 7116388Address:No. 316-318, Mei He San Road, Foodstuff Industry, Tongan Xiamen Fujian China
-
Qingdao YongFan Machinery
QINGDAO RUIHRNG is located in QingDao Shan Dong China, it professional manufacturer for jigsaw puzzle machines and jigswa dies(jigsaw moulds, SCRAPBOOKING MOULDS/SCRAPBOOKING DIES, press, cardboard supplies our machine. Main Products: 1. Jigsaw Puzzle Machine/puzzle machine/puzzle ...
Telephone:86-532-89732630Address:KongGang, QingDao, ShanDong, China
-
Weiyou Toys Devlopment Ltd.
Shenzhen Weiyou Toys Development ltd. is a toy factory in Chenghai Crescent's company. Construction since 2005, through unremitting efforts, from simple set of processing enterprises has developed into production and business as one the specialized Limited. The company operates ...
Telephone:86-0755-28309505Address:bantian, Shenzhen, China
-
Excellent Security&sound
we by and sale wolesale all kinds of things if you get some good deal feel free to sand me a email thanks
Telephone:1-718-8730852Address:5314 16av., brooklyn, n.y., USA
-
Shenzhen Longsun Electronic Co., LTD.
Shenzhen Longsun Electronic Co.,LTD.,located in Shenzhen, China, is established 2001, company concentrates on developing,designing and producing the Remote Control toys The develops 1/16 sandy beach vehicle , IW02 proportional 1/58 MINI remote control car for series of products, get a ...
Telephone:86-755-29023600Address:Xixiangbaoan, Shenzhen, Guangdong, China
-
Yuxin Science and Educational Toys Co., Ltd.
Yuxin Plastics Factory Chenghai District, Shantou City is one of the leading suppliers plastic products in China. Our factory a professional manufacturer and exporter magic cubes, puzzles, educational toys, building blocks, light up toys other functional toy sets. We can supply various ...
Telephone:86 - 754 - 88800686Address:Lianhe Industrial Zone, Fengxin Road One, Chenghai District, Shantou City, Guangdong, China. Shantou Guangdong 515041 China
-
Shenzhen Wah-lai Toys Factory
factory is mianly producing velvet stuffed toy gifts and offers brand OEM service. Our plush animal toys can be used for indoor decoration(home,kindergarten, baby playing ground),baby amusement,Teaching aid,Holiday gift,shopping mall promotion activity, wedding gift ...
Telephone:86 - 0755 - 84293312Address:????????????????? Shenzhen Guangdong China
-
CarVal Enterprises One LLC
Looking for suppliers of pinatas, party supplies and birthday supplies of good products for good prices.
Telephone:1-619-5781271Address:2838 alder grove way, chula vista, ca, USA
-
DOLLS HOUSE GALLERY
Dolls House Gallery is a small business in Adelaide South Australia area. Specializing in Dollhouses, miniatures, dollhouse furniture, dolls and accessories. Third owner of business established in same shop for over 20 years.
Telephone:61-08-82727002Address:307 FULLARTON ROAD, PARKSIDE, SOUTH AUSTRALIA, Australia
-
Qingdao Kaleer Toys Industry&Trade Co.,Ltd
Located in beautiful city Qingdao, Kaleer Industuy and Trade Co.,Ltd. has been established since 2006. As an international enterprise with solid economic foundation, we are capable to research, develop design all kinds of toys our own brand or OEM as required. ...
Telephone:86 - 0532 - 86767113Address:World Trade P.R, No.5-3, 49 Beijing Road,Bonded zone,Qingdao,P.R, China Qingdao Shandong 266500 China
-
Partner International Trade Co., LTD
Partner is a large international toys trade ***** had established in 1999.We have reseacher and design team and have excellent relationship with many toys factories.
Telephone:86-0755-13823571581Address:houhai, shenzhen, GUANGDONG, China
-
Centenary Models Trading As FP Van Der Merwe
Centenary Models Trading as FP Van Der Merwe South Africa Importing Die Cast of Cars from 1934 to 1970 mainly Scale 1/18 & 1/24.Do make exceptions now Hino Trucks.Also Exports. Â Produced under licence for Serious Collectors,so no Toys,Radio Controled Aircraft,Helicopters,Cars etc. ...
Telephone:27-011-6932386Address:13 Van Der Stel St,Culemborg Park., Randfontein, South Africa
-
Shenzhen Ankyl Trade Co., Ltd
Shenzhen Ankyl Inter Co.,Ltd is a large-scale manufacturer integrated with development,production,trade and seivice.Our company specialized in plastic toy dolls for 15 years.In recent years,we develpe more toys gifts,such as ,muslim gift, etc. Our new office located ...
Telephone:86-0755-28408989Address:Room 401,NO.588,Shenhui Road,Henggang Strict,Longgang District,Shenzhen City
-
K-power RC Servo Model Technology Co., LTD.
K-power RC Servo Model Technology Co., LTD. was established in 2005, located Qiaotou Town, Dongguan City, Guangdong Province, China. We specialized developing, designing and manufacturing various of servos, model accessories such as micro, standard, large analog digital brushless servos ...
Telephone:86-76983993238Address:No.20 2nd industrial ESTATE Heken village Qiaotou town Dongguang City Guangdong PROV. CHINA, Dongguan, Guangdong, China
-
Philips Baby Store
Buy Original Baby Strollers, Brand New Sealed With Complete Accessories 1 Year International Warranty and 6 Months Return Policy 90 Days Money Back Guarantee. Every product sold out to our customers are company class tested approved by Global standards organization. ...
Telephone:31-206110532Address:Netherlands
-
WSG Kleding CO.,LTD.
Welcome to WSG Kleding Stocklots, Overproduction, Products we provide you with the best quality stocklots at the most affordable prices. Check out the categories to the left or use the above search box to search for the stocklots you need.
Telephone:66-81-7915204Address:Postbox 148
-
Zhejiang Jiayi Crystal Crafts Factory
Jiayi crystal is a professional manufactory in item. Our company research this domain since 1998, the product includes 3D arts, Ornament, souvenir with logo, key chain, various beads, and fashions. As development of international trade, our cooperates IMPORTER & EXPORTER to get direct ...
Telephone:86-0579-83962466Address:Pujiang Town, Jinhua City, Zhejiang Province, China
Refine by Categories
- Action Figure(63)
- Action Toys(28)
- Animals & Stuffed Toys(66)
- Arts & Crafts(9)
- Arts & Crafts Toys(83)
- Baby Toys(860)
- Ball(34)
- Building Blocks(40)
- Candy Toys(20)
- Classic Toys(693)
- Dolls(105)
- Educational Toys(3090)
- Electrical Toys(51)
- Electronic Toys(1000)
- Infant Toys & Games(60)
- Inflatable Toys(791)
- Model Toys(63)
- Other Toy Categories(39)
- Other Toys(53)
- Other Toys & Hobbies(996)
- Outdoor Toys(39)
- Outdoor Toys & Structures(317)
- Plastic Toys(468)
- Plush Toys(873)
- Pretend Play & Preschool(25)
- Puzzle(12)
- Remote Control Toys(126)
- Solar Toys(9)
- Stuffed & Plush Toys(111)
- Toy Accessories(44)
- Toy Animal(1342)
- Toy Guns(19)
- Toy Vehicle(2070)
- Toy Vehicles(139)
- Wooden Toys(93)